PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 81992
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family ARF
Protein Properties Length: 382aa    MW: 42908 Da    PI: 9.576
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
81992genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B377.81.1e-24111212199
            EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
     B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
            f k lt+sd++++g +++p++ aee+       + ++   ++++ +d++g +W++++iyr++++r++lt+GW+ Fv++++L +gD+v+F   + +++el+++++
  81992 111 FSKNLTSSDTSTHGGFSVPRRAAEECfprldyqQTPP--AQEIIAKDLHGVEWKFRHIYRGQPRRHLLTTGWSVFVSQKKLVAGDTVLFV--RGDNGELRIGIR 210
            7899**************************9844343..349************************************************..3489999****9 PP

            -S CS
     B3  98 rk 99 
            r+
  81992 211 RA 212
            96 PP

2Auxin_resp128.73.5e-42238320183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 aaha+stk++F+v+YnPras++eFvv+++k++k++k+++ +GmRfkm+fetedsserr++Gt++g+ d+dp rWp+SkWr Lk
       81992 238 AAHAVSTKTMFTVFYNPRASPAEFVVPYHKYVKSFKMNILIGMRFKMRFETEDSSERRYMGTITGIGDIDPARWPGSKWRFLK 320
                 79******************************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.9E-40101223IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.57E-42103241IPR015300DNA-binding pseudobarrel domain
CDDcd100174.09E-23110211No hitNo description
PfamPF023621.6E-22111212IPR003340B3 DNA binding domain
PROSITE profilePS5086313.239111213IPR003340B3 DNA binding domain
SMARTSM010194.8E-25111213IPR003340B3 DNA binding domain
PfamPF065072.7E-39238320IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
LDSEAWHACA GPLVCLPLVG DRVVYFPQGH IEQVLASTNQ NAADLQIPQY NLPSQIFCRV  60
LNLSLGAYRE TDEVYAQMTL LFYIRISDQQ LDQSLELDEP TASSKAKLSM FSKNLTSSDT  120
STHGGFSVPR RAAEECFPRL DYQQTPPAQE IIAKDLHGVE WKFRHIYRGQ PRRHLLTTGW  180
SVFVSQKKLV AGDTVLFVRG DNGELRIGIR RAVRTQSSVT SSSLLSSHSM QIGVLAAAAH  240
AVSTKTMFTV FYNPRASPAE FVVPYHKYVK SFKMNILIGM RFKMRFETED SSERRYMGTI  300
TGIGDIDPAR WPGSKWRFLK VGWDEHAASE RQERVSPWEI EPFIAPNVTP PVALPLLRPW  360
PLGVDSKARA HLRFSGTRAR A*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B1e-135134319355Auxin response factor 1
4ldw_A1e-135134319355Auxin response factor 1
4ldv_A1e-135134319355Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002992064.10.0hypothetical protein SELMODRAFT_430287
SwissprotA2YG671e-151ARFQ_ORYSI; Auxin response factor 17
SwissprotQ653U31e-151ARFQ_ORYSJ; Auxin response factor 17
TrEMBLD8T8Y20.0D8T8Y2_SELML; Auxin response factor
STRINGEFJ069130.0(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5501582
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.31e-143auxin response factor 2